Paralogue Annotation for RYR1 residue 1347

Residue details

Gene: RYR1
Reference Sequences: Ensembl variant: ENST00000359596 / ENSP00000352608
Amino Acid Position: 1347
Reference Amino Acid: G - Glycine
Protein Domain:


Paralogue Variants mapped to RYR1 residue 1347

No paralogue variants have been mapped to residue 1347 for RYR1.



RYR1PAEDEARAAEPDPDYENLRRSAGGWSEAEN>G<KEGTAKEGAPGGTPQAGGEAQPARAENEKD1377
RYR2PK-NDLEDYDADSDFEVLMKTAHGHLVPDR>V<DKDKEATKPEFNNHK--------------D1375
RYR3------------------------------>-<------------------------------
cons                              > <                              

See full Alignment of Paralogues


Known Variants in RYR1

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.G1347Sc.4039G>A Putative BenignSIFT: tolerated
Polyphen: benign