Paralogue Annotation for RYR1 residue 1368

Residue details

Gene: RYR1
Reference Sequences: Ensembl variant: ENST00000359596 / ENSP00000352608
Amino Acid Position: 1368
Reference Amino Acid: Q - Glutamine
Protein Domain:


Paralogue Variants mapped to RYR1 residue 1368

No paralogue variants have been mapped to residue 1368 for RYR1.



RYR1AGGWSEAENGKEGTAKEGAPGGTPQAGGEA>Q<PARAENEKDATTEKNKKRGFLFKAKKVAMM1398
RYR2AHGHLVPDRVDKDKEATKPEFNNHK----->-<--------DYAQEKP-SR--LKQRFLLRRT1393
RYR3------------------------------>-<------------------------------
cons                              > <                              

See full Alignment of Paralogues


Known Variants in RYR1

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.Q1368Pc.4103A>C Putative BenignSIFT:
Polyphen: benign