Paralogue Annotation for RYR1 residue 1371

Residue details

Gene: RYR1
Reference Sequences: Ensembl variant: ENST00000359596 / ENSP00000352608
Amino Acid Position: 1371
Reference Amino Acid: R - Arginine
Protein Domain:


Paralogue Variants mapped to RYR1 residue 1371

No paralogue variants have been mapped to residue 1371 for RYR1.



RYR1WSEAENGKEGTAKEGAPGGTPQAGGEAQPA>R<AENEKDATTEKNKKRGFLFKAKKVAMMTQP1401
RYR2HLVPDRVDKDKEATKPEFNNHK-------->-<-----DYAQEKP-SR--LKQRFLLRRTKPD1396
RYR3------------------------------>-<------------------------------
cons                              > <                              

See full Alignment of Paralogues


Known Variants in RYR1

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.R1371Sc.4113G>C Putative BenignSIFT: tolerated
Polyphen: benign