Paralogue Annotation for RYR1 residue 1405

Residue details

Gene: RYR1
Reference Sequences: Ensembl variant: ENST00000359596 / ENSP00000352608
Amino Acid Position: 1405
Reference Amino Acid: P - Proline
Protein Domain:


Paralogue Variants mapped to RYR1 residue 1405

No paralogue variants have been mapped to residue 1405 for RYR1.



RYR1EKDATTEKNKKRGFLFKAKKVAMMTQPPAT>P<TLPRLPHDVVPADNRDDPEIILNTTTYYYS1435
RYR2--DYAQEKP-SR--LKQRFLLRRTKPDYST>S<HSARLTEDVLADDRDDYDFLMQT-STYYYS1429
RYR3------------------------------>-<-SPCLDSEAFQKRKQMQEILSHTTTQCYYA1331
cons                              > <                              

See full Alignment of Paralogues


Known Variants in RYR1

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.P1405Tc.4213C>A Putative BenignSIFT: tolerated
Polyphen: possibly damaging