Paralogue Annotation for RYR1 residue 1406

Residue details

Gene: RYR1
Reference Sequences: Ensembl variant: ENST00000359596 / ENSP00000352608
Amino Acid Position: 1406
Reference Amino Acid: T - Threonine
Protein Domain:


Paralogue Variants mapped to RYR1 residue 1406

No paralogue variants have been mapped to residue 1406 for RYR1.



RYR1KDATTEKNKKRGFLFKAKKVAMMTQPPATP>T<LPRLPHDVVPADNRDDPEIILNTTTYYYSV1436
RYR2-DYAQEKP-SR--LKQRFLLRRTKPDYSTS>H<SARLTEDVLADDRDDYDFLMQT-STYYYSV1430
RYR3------------------------------>-<SPCLDSEAFQKRKQMQEILSHTTTQCYYAI1332
cons                              > <                              

See full Alignment of Paralogues


Known Variants in RYR1

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.T1406Mc.4217C>T Putative BenignSIFT:
Polyphen: benign