Paralogue Annotation for RYR1 residue 1411

Residue details

Gene: RYR1
Reference Sequences: Ensembl variant: ENST00000359596 / ENSP00000352608
Amino Acid Position: 1411
Reference Amino Acid: P - Proline
Protein Domain:


Paralogue Variants mapped to RYR1 residue 1411

No paralogue variants have been mapped to residue 1411 for RYR1.



RYR1EKNKKRGFLFKAKKVAMMTQPPATPTLPRL>P<HDVVPADNRDDPEIILNTTTYYYSVRVFAG1441
RYR2EKP-SR--LKQRFLLRRTKPDYSTSHSARL>T<EDVLADDRDDYDFLMQT-STYYYSVRIFPG1435
RYR3--------------------------SPCL>D<SEAFQKRKQMQEILSHTTTQCYYAIRIFAG1337
cons                              > <                              

See full Alignment of Paralogues


Known Variants in RYR1

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.P1411Ac.4231C>G BenignSIFT:
Polyphen: benign