Paralogue Annotation for RYR1 residue 1412

Residue details

Gene: RYR1
Reference Sequences: Ensembl variant: ENST00000359596 / ENSP00000352608
Amino Acid Position: 1412
Reference Amino Acid: H - Histidine
Protein Domain:


Paralogue Variants mapped to RYR1 residue 1412

No paralogue variants have been mapped to residue 1412 for RYR1.



RYR1KNKKRGFLFKAKKVAMMTQPPATPTLPRLP>H<DVVPADNRDDPEIILNTTTYYYSVRVFAGQ1442
RYR2KP-SR--LKQRFLLRRTKPDYSTSHSARLT>E<DVLADDRDDYDFLMQT-STYYYSVRIFPGQ1436
RYR3-------------------------SPCLD>S<EAFQKRKQMQEILSHTTTQCYYAIRIFAGQ1338
cons                              > <                              

See full Alignment of Paralogues


Known Variants in RYR1

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.H1412Qc.4236C>G Putative BenignSIFT:
Polyphen: benign