Paralogue Annotation for RYR1 residue 1413

Residue details

Gene: RYR1
Reference Sequences: Ensembl variant: ENST00000359596 / ENSP00000352608
Amino Acid Position: 1413
Reference Amino Acid: D - Aspartate
Protein Domain:


Paralogue Variants mapped to RYR1 residue 1413

No paralogue variants have been mapped to residue 1413 for RYR1.



RYR1NKKRGFLFKAKKVAMMTQPPATPTLPRLPH>D<VVPADNRDDPEIILNTTTYYYSVRVFAGQE1443
RYR2P-SR--LKQRFLLRRTKPDYSTSHSARLTE>D<VLADDRDDYDFLMQT-STYYYSVRIFPGQE1437
RYR3------------------------SPCLDS>E<AFQKRKQMQEILSHTTTQCYYAIRIFAGQD1339
cons                              > <                              

See full Alignment of Paralogues


Known Variants in RYR1

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.D1413Nc.4237G>A Putative BenignSIFT:
Polyphen: possibly damaging