Paralogue Annotation for RYR1 residue 1447

Residue details

Gene: RYR1
Reference Sequences: Ensembl variant: ENST00000359596 / ENSP00000352608
Amino Acid Position: 1447
Reference Amino Acid: V - Valine
Protein Domain:


Paralogue Variants mapped to RYR1 residue 1447

No paralogue variants have been mapped to residue 1447 for RYR1.



RYR1ADNRDDPEIILNTTTYYYSVRVFAGQEPSC>V<WAGWVTPDYHQHDMSFDLSKVRVVTVTMGD1477
RYR2DDRDDYDFLMQT-STYYYSVRIFPGQEPAN>V<WVGWITSDFHQYDTGFDLDRVRTVTVTLGD1471
RYR3KRKQMQEILSHTTTQCYYAIRIFAGQDPSC>V<WVGWVTPDYHLYSEKFDLNKNCTVTVTLGD1373
cons                              > <                              

See full Alignment of Paralogues


Known Variants in RYR1

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.V1447Mc.4339G>A Putative BenignSIFT: deleterious
Polyphen: probably damaging