Paralogue Annotation for RYR1 residue 1464

Residue details

Gene: RYR1
Reference Sequences: Ensembl variant: ENST00000359596 / ENSP00000352608
Amino Acid Position: 1464
Reference Amino Acid: D - Aspartate
Protein Domain:


Paralogue Variants mapped to RYR1 residue 1464

No paralogue variants have been mapped to residue 1464 for RYR1.



RYR1YSVRVFAGQEPSCVWAGWVTPDYHQHDMSF>D<LSKVRVVTVTMGDEQGNVHSSLKCSNCYMV1494
RYR2YSVRIFPGQEPANVWVGWITSDFHQYDTGF>D<LDRVRTVTVTLGDEKGKVHESIKRSNCYMV1488
RYR3YAIRIFAGQDPSCVWVGWVTPDYHLYSEKF>D<LNKNCTVTVTLGDERGRVHESVKRSNCYMV1390
cons                              > <                              

See full Alignment of Paralogues


Known Variants in RYR1

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.D1464Nc.4390G>A Putative BenignSIFT: tolerated
Polyphen: probably damaging