Paralogue Annotation for RYR1 residue 148

Residue details

Gene: RYR1
Reference Sequences: Ensembl variant: ENST00000359596 / ENSP00000352608
Amino Acid Position: 148
Reference Amino Acid: T - Threonine
Protein Domain:


Paralogue Variants mapped to RYR1 residue 148

No paralogue variants have been mapped to residue 148 for RYR1.



RYR1SCLTTSRSMTDKLAFDVGLQEDATGEACWW>T<MHPASKQRSEGEKVRVGDDIILVSVSSERY178
RYR2CCLSTSRSSTDKLAFDVGLQEDTTGEACWW>T<IHPASKQRSEGEKVRVGDDLILVSVSSERY191
RYR3TCLTTSRSQTDKLAFDVGLREHATGEACWW>T<IHPASKQRSEGEKVRIGDDLILVSVSSERY181
cons                              > <                              

See full Alignment of Paralogues


Known Variants in RYR1

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.T148Ic.443C>T Putative BenignSIFT:
Polyphen: probably damaging