Paralogue Annotation for RYR1 residue 155

Residue details

Gene: RYR1
Reference Sequences: Ensembl variant: ENST00000359596 / ENSP00000352608
Amino Acid Position: 155
Reference Amino Acid: Q - Glutamine
Protein Domain:


Paralogue Variants mapped to RYR1 residue 155

No paralogue variants have been mapped to residue 155 for RYR1.



RYR1SMTDKLAFDVGLQEDATGEACWWTMHPASK>Q<RSEGEKVRVGDDIILVSVSSERYLHLSTAS185
RYR2SSTDKLAFDVGLQEDTTGEACWWTIHPASK>Q<RSEGEKVRVGDDLILVSVSSERYLHLSYGN198
RYR3SQTDKLAFDVGLREHATGEACWWTIHPASK>Q<RSEGEKVRIGDDLILVSVSSERYLHLSVSN188
cons                              > <                              

See full Alignment of Paralogues


Known Variants in RYR1

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.Q155Kc.463C>A Other MyopathySIFT:
Polyphen:
ReportsOther Myopathy Mutations in RYR1 in malignant hyperthermia and central core disease. Hum Mutat. 2006 27(10):977-89. 16917943