Paralogue Annotation for RYR1 residue 1606

Residue details

Gene: RYR1
Reference Sequences: Ensembl variant: ENST00000359596 / ENSP00000352608
Amino Acid Position: 1606
Reference Amino Acid: R - Arginine
Protein Domain:


Paralogue Variants mapped to RYR1 residue 1606

No paralogue variants have been mapped to residue 1606 for RYR1.



RYR1AAMFQSERKNPAPQCPPRLEMQMLMPVSWS>R<MPNHFLQVETRRAGERLGWAVQCQEPLTMM1636
RYR2AGLFKSEHKNPVPQCPPRLHVQFLSHVLWS>R<MPNQFLKVDVSRISERQGWLVQCLDPLQFM1628
RYR3AAIFRSEEKNPVPQCPPRLDVQTIQPVLWS>R<MPNSFLKVETERVSERHGWVVQCLEPLQMM1532
cons                              > <                              

See full Alignment of Paralogues


Known Variants in RYR1

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.R1606Cc.4816C>T Other MyopathySIFT:
Polyphen:
ReportsOther Myopathy RYR1 mutations are a common cause of congenital myopathies with central nuclei. Ann Neurol. 2010 68(5):717-26. 20839240
p.R1606Hc.4817G>A Putative BenignSIFT: deleterious
Polyphen: probably damaging