Paralogue Annotation for RYR1 residue 1620

Residue details

Gene: RYR1
Reference Sequences: Ensembl variant: ENST00000359596 / ENSP00000352608
Amino Acid Position: 1620
Reference Amino Acid: G - Glycine
Protein Domain:


Paralogue Variants mapped to RYR1 residue 1620

No paralogue variants have been mapped to residue 1620 for RYR1.



RYR1CPPRLEMQMLMPVSWSRMPNHFLQVETRRA>G<ERLGWAVQCQEPLTMMALHIPEENRCMDIL1650
RYR2CPPRLHVQFLSHVLWSRMPNQFLKVDVSRI>S<ERQGWLVQCLDPLQFMSLHIPEENRSVDIL1642
RYR3CPPRLDVQTIQPVLWSRMPNSFLKVETERV>S<ERHGWVVQCLEPLQMMALHIPEENRCVDIL1546
cons                              > <                              

See full Alignment of Paralogues


Known Variants in RYR1

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.G1620Sc.4858G>A Putative BenignSIFT:
Polyphen: benign