Paralogue Annotation for RYR1 residue 1627

Residue details

Gene: RYR1
Reference Sequences: Ensembl variant: ENST00000359596 / ENSP00000352608
Amino Acid Position: 1627
Reference Amino Acid: V - Valine
Protein Domain:


Paralogue Variants mapped to RYR1 residue 1627

No paralogue variants have been mapped to residue 1627 for RYR1.



RYR1QMLMPVSWSRMPNHFLQVETRRAGERLGWA>V<QCQEPLTMMALHIPEENRCMDILELSERLD1657
RYR2QFLSHVLWSRMPNQFLKVDVSRISERQGWL>V<QCLDPLQFMSLHIPEENRSVDILELTEQEE1649
RYR3QTIQPVLWSRMPNSFLKVETERVSERHGWV>V<QCLEPLQMMALHIPEENRCVDILELCEQED1553
cons                              > <                              

See full Alignment of Paralogues


Known Variants in RYR1

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.V1627Mc.4879G>A Putative BenignSIFT: tolerated
Polyphen: probably damaging