Paralogue Annotation for RYR1 residue 1645

Residue details

Gene: RYR1
Reference Sequences: Ensembl variant: ENST00000359596 / ENSP00000352608
Amino Acid Position: 1645
Reference Amino Acid: R - Arginine
Protein Domain:


Paralogue Variants mapped to RYR1 residue 1645

No paralogue variants have been mapped to residue 1645 for RYR1.



RYR1ETRRAGERLGWAVQCQEPLTMMALHIPEEN>R<CMDILELSERLDLQRFHSHTLRLYRAVCAL1675
RYR2DVSRISERQGWLVQCLDPLQFMSLHIPEEN>R<SVDILELTEQEELLKFHYHTLRLYSAVCAL1667
RYR3ETERVSERHGWVVQCLEPLQMMALHIPEEN>R<CVDILELCEQEDLMRFHYHTLRLYSAVCAL1571
cons                              > <                              

See full Alignment of Paralogues


Known Variants in RYR1

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.R1645Qc.4934G>A Other MyopathySIFT:
Polyphen: probably damaging
ReportsOther Myopathy Null mutations causing depletion of the type 1 ryanodine receptor (RYR1) are commonly associated with recessive structural congenital myopathies with cores. Hum Mutat. 2008 29(5):670-8. 18253926