Paralogue Annotation for RYR1 residue 165

Residue details

Gene: RYR1
Reference Sequences: Ensembl variant: ENST00000359596 / ENSP00000352608
Amino Acid Position: 165
Reference Amino Acid: G - Glycine
Protein Domain:


Paralogue Variants mapped to RYR1 residue 165

ParalogueVariantAssociated DiseaseMapping QualityConsensusPubmed
RYR2G178ACatecholaminergic polymorphic ventricular tachycarHigh9 26114861

To assess whether the paralogue annotation here confidently predicts that variation at this residue is pathogenic, it is important to check the reports in the Pubmed links above to ascertain that the mutations in these paralogues have been proved likely to be disease-causing. It is also important to check that the direction of effect of the variant in the paralogue is compatible with your observed phenotype in RYR1.



RYR1GLQEDATGEACWWTMHPASKQRSEGEKVRV>G<DDIILVSVSSERYLHLSTASGELQVDASFM195
RYR2GLQEDTTGEACWWTIHPASKQRSEGEKVRV>G<DDLILVSVSSERYLHLSYGNGSLHVDAAFQ208
RYR3GLREHATGEACWWTIHPASKQRSEGEKVRI>G<DDLILVSVSSERYLHLSVSNGNIQVDASFM198
cons                              > <                              

See full Alignment of Paralogues


Known Variants in RYR1

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.G165Rc.493G>A Other MyopathySIFT:
Polyphen:
ReportsOther Myopathy Correlations between genotype and pharmacological, histological, functional, and clinical phenotypes in malignant hyperthermia susceptibility. Hum Mutat. 2005 26(5):413-25. 16163667