Paralogue Annotation for RYR1 residue 166

Residue details

Gene: RYR1
Reference Sequences: Ensembl variant: ENST00000359596 / ENSP00000352608
Amino Acid Position: 166
Reference Amino Acid: D - Aspartate
Protein Domain:


Paralogue Variants mapped to RYR1 residue 166

No paralogue variants have been mapped to residue 166 for RYR1.



RYR1LQEDATGEACWWTMHPASKQRSEGEKVRVG>D<DIILVSVSSERYLHLSTASGELQVDASFMQ196
RYR2LQEDTTGEACWWTIHPASKQRSEGEKVRVG>D<DLILVSVSSERYLHLSYGNGSLHVDAAFQQ209
RYR3LREHATGEACWWTIHPASKQRSEGEKVRIG>D<DLILVSVSSERYLHLSVSNGNIQVDASFMQ199
cons                              > <                              

See full Alignment of Paralogues


Known Variants in RYR1

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.D166Gc.497A>G Other MyopathySIFT:
Polyphen:
ReportsOther Myopathy Mutations in RYR1 in malignant hyperthermia and central core disease. Hum Mutat. 2006 27(10):977-89. 16917943
p.D166Nc.496G>A Other MyopathySIFT:
Polyphen:
ReportsOther Myopathy Mutation screening in the ryanodine receptor 1 gene (RYR1) in patients susceptible to malignant hyperthermia who show definite IVCT results: identification of three novel mutations. Acta Anaesthesiol Scand. 2002 46(6):692-8. 12059893