Paralogue Annotation for RYR1 residue 1673

Residue details

Gene: RYR1
Reference Sequences: Ensembl variant: ENST00000359596 / ENSP00000352608
Amino Acid Position: 1673
Reference Amino Acid: C - Cysteine
Protein Domain:


Paralogue Variants mapped to RYR1 residue 1673

No paralogue variants have been mapped to residue 1673 for RYR1.



RYR1ENRCMDILELSERLDLQRFHSHTLRLYRAV>C<ALGNNRVAHALCSHVDQAQLLHALEDAHLP1703
RYR2ENRSVDILELTEQEELLKFHYHTLRLYSAV>C<ALGNHRVAHALCSHVDEPQLLYAIENKYMP1695
RYR3ENRCVDILELCEQEDLMRFHYHTLRLYSAV>C<ALGNSRVAYALCSHVDLSQLFYAIDNKYLP1599
cons                              > <                              

See full Alignment of Paralogues


Known Variants in RYR1

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.C1673Rc.5017T>C Other MyopathySIFT:
Polyphen:
ReportsOther Myopathy Severe congenital RYR1-associated myopathy: the expanding clinicopathologic and genetic spectrum. Neurology. 2013 80(17):1584-9. doi: 10.1212/WNL.0b013e3182900380. 23553484