Paralogue Annotation for RYR1 residue 1753

Residue details

Gene: RYR1
Reference Sequences: Ensembl variant: ENST00000359596 / ENSP00000352608
Amino Acid Position: 1753
Reference Amino Acid: T - Threonine
Protein Domain:


Paralogue Variants mapped to RYR1 residue 1753

No paralogue variants have been mapped to residue 1753 for RYR1.



RYR1CRSRRSMLSEYIVPLTPETRAITLFPPGRS>T<ENGHPRHGLPGVGVTTSLRPPHHFSPPCFV1783
RYR2ATARLMMNNEYIVPMTEETKSITLFPD--->-<--ENKKHGLPGIGLSTSLRPRMQFSSPSFV1769
RYR3KERKLMMKNEYIIPITSTTRNIRLFPD--->-<--ESKRHGLPGVGLRTCLKPGFRFSTPCFV1673
cons                              > <                              

See full Alignment of Paralogues


Known Variants in RYR1

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.T1753Ic.5258C>T Putative BenignSIFT: tolerated
Polyphen: benign