Paralogue Annotation for RYR1 residue 177

Residue details

Gene: RYR1
Reference Sequences: Ensembl variant: ENST00000359596 / ENSP00000352608
Amino Acid Position: 177
Reference Amino Acid: R - Arginine
Protein Domain:


Paralogue Variants mapped to RYR1 residue 177

No paralogue variants have been mapped to residue 177 for RYR1.



RYR1WTMHPASKQRSEGEKVRVGDDIILVSVSSE>R<YLHLSTASGELQVDASFMQTLWNMNPICSR207
RYR2WTIHPASKQRSEGEKVRVGDDLILVSVSSE>R<YLHLSYGNGSLHVDAAFQQTLWSVAPISSG220
RYR3WTIHPASKQRSEGEKVRIGDDLILVSVSSE>R<YLHLSVSNGNIQVDASFMQTLWNVHPTCSG210
cons                              > <                              

See full Alignment of Paralogues


Known Variants in RYR1

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.R177Cc.529C>T Other MyopathySIFT:
Polyphen:
ReportsOther Myopathy Correlations between genotype and pharmacological, histological, functional, and clinical phenotypes in malignant hyperthermia susceptibility. Hum Mutat. 2005 26(5):413-25. 16163667
Other Myopathy Crystal structure of type I ryanodine receptor amino-terminal beta-trefoil domain reveals a disease-associated mutation "hot spot" loop. Proc Natl Acad Sci U S A. 2009 106(27):11040-4. doi: 10.1073/pnas.0905186106. 19541610
Other Myopathy Genetic variation in RYR1 and malignant hyperthermia phenotypes. Br J Anaesth. 2009 103(4):538-48. doi: 10.1093/bja/aep204. 19648156
p.R177Hc.530G>A Putative BenignSIFT:
Polyphen: