Paralogue Annotation for RYR1 residue 1809

Residue details

Gene: RYR1
Reference Sequences: Ensembl variant: ENST00000359596 / ENSP00000352608
Amino Acid Position: 1809
Reference Amino Acid: D - Aspartate
Protein Domain:


Paralogue Variants mapped to RYR1 residue 1809

No paralogue variants have been mapped to residue 1809 for RYR1.



RYR1PPCFVAALPAAGAAEAPARLSPAIPLEALR>D<KALRMLGEAVRDGGQHARDPVGGSVEFQFV1839
RYR2SPSFVSI------SNECYQYSPEFPLDILK>S<KTIQMLTEAVKEGSLHARDPVGGTTEFLFV1819
RYR3TPCFVVT------GEDHQKQSPEIPLESLR>T<KALSMLTEAVQCSGAHIRDPVGGSVEFQFV1723
cons                              > <                              

See full Alignment of Paralogues


Known Variants in RYR1

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.D1809Ec.5427C>G Putative Benignrs201086478SIFT:
Polyphen: benign