Paralogue Annotation for RYR1 residue 1814

Residue details

Gene: RYR1
Reference Sequences: Ensembl variant: ENST00000359596 / ENSP00000352608
Amino Acid Position: 1814
Reference Amino Acid: M - Methionine
Protein Domain:


Paralogue Variants mapped to RYR1 residue 1814

No paralogue variants have been mapped to residue 1814 for RYR1.



RYR1AALPAAGAAEAPARLSPAIPLEALRDKALR>M<LGEAVRDGGQHARDPVGGSVEFQFVPVLKL1844
RYR2SI------SNECYQYSPEFPLDILKSKTIQ>M<LTEAVKEGSLHARDPVGGTTEFLFVPLIKL1824
RYR3VT------GEDHQKQSPEIPLESLRTKALS>M<LTEAVQCSGAHIRDPVGGSVEFQFVPVLKL1728
cons                              > <                              

See full Alignment of Paralogues


Known Variants in RYR1

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.M1814Kc.5441T>A Other MyopathySIFT:
Polyphen:
ReportsOther Myopathy Mutations in RYR1 in malignant hyperthermia and central core disease. Hum Mutat. 2006 27(10):977-89. 16917943