Paralogue Annotation for RYR1 residue 1825

Residue details

Gene: RYR1
Reference Sequences: Ensembl variant: ENST00000359596 / ENSP00000352608
Amino Acid Position: 1825
Reference Amino Acid: H - Histidine
Protein Domain:


Paralogue Variants mapped to RYR1 residue 1825

No paralogue variants have been mapped to residue 1825 for RYR1.



RYR1PARLSPAIPLEALRDKALRMLGEAVRDGGQ>H<ARDPVGGSVEFQFVPVLKLVSTLLVMGIFG1855
RYR2CYQYSPEFPLDILKSKTIQMLTEAVKEGSL>H<ARDPVGGTTEFLFVPLIKLFYTLLIMGIFH1835
RYR3HQKQSPEIPLESLRTKALSMLTEAVQCSGA>H<IRDPVGGSVEFQFVPVLKLIGTLLVMGVFD1739
cons                              > <                              

See full Alignment of Paralogues


Known Variants in RYR1

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.H1825Nc.5473C>A Putative BenignSIFT: tolerated
Polyphen: possibly damaging