Paralogue Annotation for RYR1 residue 1830

Residue details

Gene: RYR1
Reference Sequences: Ensembl variant: ENST00000359596 / ENSP00000352608
Amino Acid Position: 1830
Reference Amino Acid: V - Valine
Protein Domain:


Paralogue Variants mapped to RYR1 residue 1830

ParalogueVariantAssociated DiseaseMapping QualityConsensusPubmed
RYR2V1810LCatecholaminergic polymorphic ventricular tachycarHigh9 22396703, 24025405, 24978818

To assess whether the paralogue annotation here confidently predicts that variation at this residue is pathogenic, it is important to check the reports in the Pubmed links above to ascertain that the mutations in these paralogues have been proved likely to be disease-causing. It is also important to check that the direction of effect of the variant in the paralogue is compatible with your observed phenotype in RYR1.



RYR1PAIPLEALRDKALRMLGEAVRDGGQHARDP>V<GGSVEFQFVPVLKLVSTLLVMGIFGDEDVK1860
RYR2PEFPLDILKSKTIQMLTEAVKEGSLHARDP>V<GGTTEFLFVPLIKLFYTLLIMGIFHNEDLK1840
RYR3PEIPLESLRTKALSMLTEAVQCSGAHIRDP>V<GGSVEFQFVPVLKLIGTLLVMGVFDDDDVR1744
cons                              > <                              

See full Alignment of Paralogues


Known Variants in RYR1

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.V1830Ic.5488G>A Putative BenignSIFT:
Polyphen: probably damaging