Paralogue Annotation for RYR1 residue 1832

Residue details

Gene: RYR1
Reference Sequences: Ensembl variant: ENST00000359596 / ENSP00000352608
Amino Acid Position: 1832
Reference Amino Acid: G - Glycine
Protein Domain:


Paralogue Variants mapped to RYR1 residue 1832

No paralogue variants have been mapped to residue 1832 for RYR1.



RYR1IPLEALRDKALRMLGEAVRDGGQHARDPVG>G<SVEFQFVPVLKLVSTLLVMGIFGDEDVKQI1862
RYR2FPLDILKSKTIQMLTEAVKEGSLHARDPVG>G<TTEFLFVPLIKLFYTLLIMGIFHNEDLKHI1842
RYR3IPLESLRTKALSMLTEAVQCSGAHIRDPVG>G<SVEFQFVPVLKLIGTLLVMGVFDDDDVRQI1746
cons                              > <                              

See full Alignment of Paralogues


Known Variants in RYR1

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.G1832Ac.5495G>C Putative BenignSIFT:
Polyphen: probably damaging
ReportsUnknown Clinical utility gene card for: Multi-minicore disease. Eur J Hum Genet. 2012 20(2). doi: 10.1038/ejhg.2011.180. 22009146
p.G1832Dc.5495G>A Putative BenignSIFT:
Polyphen: