Paralogue Annotation for RYR1 residue 1851

Residue details

Gene: RYR1
Reference Sequences: Ensembl variant: ENST00000359596 / ENSP00000352608
Amino Acid Position: 1851
Reference Amino Acid: M - Methionine
Protein Domain:


Paralogue Variants mapped to RYR1 residue 1851

No paralogue variants have been mapped to residue 1851 for RYR1.



RYR1DGGQHARDPVGGSVEFQFVPVLKLVSTLLV>M<GIFGDEDVKQILKMIEPEVFTEEEEEEDEE1881
RYR2EGSLHARDPVGGTTEFLFVPLIKLFYTLLI>M<GIFHNEDLKHILQLIEPSVFKEAATPEEES1861
RYR3CSGAHIRDPVGGSVEFQFVPVLKLIGTLLV>M<GVFDDDDVRQILLLIDPSVFGEHSAGTEEG1765
cons                              > <                              

See full Alignment of Paralogues


Known Variants in RYR1

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.M1851Tc.5552T>C Putative BenignSIFT:
Polyphen: possibly damaging