Paralogue Annotation for RYR1 residue 1872

Residue details

Gene: RYR1
Reference Sequences: Ensembl variant: ENST00000359596 / ENSP00000352608
Amino Acid Position: 1872
Reference Amino Acid: T - Threonine
Protein Domain:


Paralogue Variants mapped to RYR1 residue 1872

No paralogue variants have been mapped to residue 1872 for RYR1.



RYR1LKLVSTLLVMGIFGDEDVKQILKMIEPEVF>T<EEEEEEDEEEEGEEEDEEEKEEDEEETAQE1902
RYR2IKLFYTLLIMGIFHNEDLKHILQLIEPSVF>K<EAATPEEESDTL--E-K---ELS----VDD1872
RYR3LKLIGTLLVMGVFDDDDVRQILLLIDPSVF>G<EHSAGTEEGAEK--E-E---VTQ----VEE1776
cons                              > <                              

See full Alignment of Paralogues


Known Variants in RYR1

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.T1872Ic.5615C>T Putative BenignSIFT: tolerated
Polyphen: possibly damaging