Paralogue Annotation for RYR1 residue 1878

Residue details

Gene: RYR1
Reference Sequences: Ensembl variant: ENST00000359596 / ENSP00000352608
Amino Acid Position: 1878
Reference Amino Acid: E - Glutamate
Protein Domain:


Paralogue Variants mapped to RYR1 residue 1878

No paralogue variants have been mapped to residue 1878 for RYR1.



RYR1LLVMGIFGDEDVKQILKMIEPEVFTEEEEE>E<DEEEEGEEEDEEEKEEDEEETAQEKEDEEK1908
RYR2LLIMGIFHNEDLKHILQLIEPSVFKEAATP>E<EESDTL--E-K---ELS----VDDAK-LQG1877
RYR3LLVMGVFDDDDVRQILLLIDPSVFGEHSAG>T<EEGAEK--E-E---VTQ----VEEKA-VEA1781
cons                              > <                              

See full Alignment of Paralogues


Known Variants in RYR1

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.E1878Dc.5634G>C BenignSIFT:
Polyphen: benign