Paralogue Annotation for RYR1 residue 1925

Residue details

Gene: RYR1
Reference Sequences: Ensembl variant: ENST00000359596 / ENSP00000352608
Amino Acid Position: 1925
Reference Amino Acid: G - Glycine
Protein Domain:


Paralogue Variants mapped to RYR1 residue 1925

No paralogue variants have been mapped to residue 1925 for RYR1.



RYR1DEEETAQEKEDEEKEEEEAAEGEKEEGLEE>G<LLQMKLPESVKLQMCHLLEYFCDQELQHRV1955
RYR2S----VDDAK-LQGAGEE--EAKGGKRPKE>G<LLQMKLPEPVKLQMCLLLQYLCDCQVRHRI1922
RYR3Q----VEEKA-VEAG-----EKAGKEAPVK>G<LLQTRLPESVKLQMCELLSYLCDCELQHRV1823
cons                              > <                              

See full Alignment of Paralogues


Known Variants in RYR1

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.G1925Rc.5773G>A Putative BenignSIFT:
Polyphen: probably damaging