Paralogue Annotation for RYR1 residue 1997

Residue details

Gene: RYR1
Reference Sequences: Ensembl variant: ENST00000359596 / ENSP00000352608
Amino Acid Position: 1997
Reference Amino Acid: E - Glutamate
Protein Domain:


Paralogue Variants mapped to RYR1 residue 1997

No paralogue variants have been mapped to residue 1997 for RYR1.



RYR1DKLQANQRSRYGLLIKAFSMTAAETARRTR>E<FRSPPQEQINMLLQFKDGTDEEDCPLPEEI2027
RYR2AKLQDNQRFRYNEVMQALNMSAALTARKTK>E<FRSPPQEQINMLLNFKD--DKSECPCPEEI1992
RYR3SKLQANQKFRYNELMQALNMSAALTARKTK>E<FRSPPQEQINMLLNFQL--GE-NCPCPEEI1892
cons                              > <                              

See full Alignment of Paralogues


Known Variants in RYR1

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.E1997Kc.5989G>A Other Disease PhenotypeSIFT:
Polyphen:
ReportsOther Disease Phenotype Next generation sequencing in a large cohort of patients presenting with neuromuscular disease before or at birth. Orphanet J Rare Dis. 2015 10:148. doi: 10.1186/s13023-015-0364-0. 26578207