Paralogue Annotation for RYR1 residue 204

Residue details

Gene: RYR1
Reference Sequences: Ensembl variant: ENST00000359596 / ENSP00000352608
Amino Acid Position: 204
Reference Amino Acid: I - Isoleucine
Protein Domain:


Paralogue Variants mapped to RYR1 residue 204

ParalogueVariantAssociated DiseaseMapping QualityConsensusPubmed
RYR2I217VLong QT syndromeHigh8 22677073, 24025405, 27153395, 27194543

To assess whether the paralogue annotation here confidently predicts that variation at this residue is pathogenic, it is important to check the reports in the Pubmed links above to ascertain that the mutations in these paralogues have been proved likely to be disease-causing. It is also important to check that the direction of effect of the variant in the paralogue is compatible with your observed phenotype in RYR1.



RYR1SSERYLHLSTASGELQVDASFMQTLWNMNP>I<CSR--CEEGFVTGGHVLRLFHGHMDECLTI232
RYR2SSERYLHLSYGNGSLHVDAAFQQTLWSVAP>I<SSGSEAAQGYLIGGDVLRLLHGHMDECLTV247
RYR3SSERYLHLSVSNGNIQVDASFMQTLWNVHP>T<CSGSSIEEGYLLGGHVVRLFHGH-DECLTI236
cons                              > <                              

See full Alignment of Paralogues


Known Variants in RYR1

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.I204Vc.610A>G Putative BenignSIFT:
Polyphen: benign