Paralogue Annotation for RYR1 residue 2087

Residue details

Gene: RYR1
Reference Sequences: Ensembl variant: ENST00000359596 / ENSP00000352608
Amino Acid Position: 2087
Reference Amino Acid: E - Glutamate
Protein Domain:


Paralogue Variants mapped to RYR1 residue 2087

No paralogue variants have been mapped to residue 2087 for RYR1.



RYR1TTLGSRLMSLLEKVRLVKKKEEKPEEERSA>E<ESKPRSLQELVSHMVVRWAQEDFVQSPELV2117
RYR2LTIRGRLLSLVEKVTYLKKKQA--EKPVES>D<SKKSSTLQQLISETMVRWAQESVIEDPELV2081
RYR3TSWTGKLCALVYKIKGPPKPEK--EQPTEE>E<ERCPTTLKELISQTMICWAQEDQIQDSELV1979
cons                              > <                              

See full Alignment of Paralogues


Known Variants in RYR1

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.E2087Dc.6261G>C Putative BenignSIFT: tolerated
Polyphen: benign
p.E2087Kc.6259G>A Putative BenignSIFT: tolerated
Polyphen: benign