Paralogue Annotation for RYR1 residue 2117

Residue details

Gene: RYR1
Reference Sequences: Ensembl variant: ENST00000359596 / ENSP00000352608
Amino Acid Position: 2117
Reference Amino Acid: V - Valine
Protein Domain:


Paralogue Variants mapped to RYR1 residue 2117

No paralogue variants have been mapped to residue 2117 for RYR1.



RYR1EESKPRSLQELVSHMVVRWAQEDFVQSPEL>V<RAMFSLLHRQYDGLGELLRALPRAYTISPS2147
RYR2DSKKSSTLQQLISETMVRWAQESVIEDPEL>V<RAMFVLLHRQYDGIGGLVRALPKTYTINGV2111
RYR3EERCPTTLKELISQTMICWAQEDQIQDSEL>V<RMMFNLLRRQYDSIGELLQALRKTYTISHT2009
cons                              > <                              

See full Alignment of Paralogues


Known Variants in RYR1

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.V2117Lc.6349G>C Other MyopathySIFT:
Polyphen:
ReportsOther Myopathy Scanning for mutations of the ryanodine receptor (RYR1) gene by denaturing HPLC: detection of three novel malignant hyperthermia alleles. Clin Chem. 2003 49(5):761-8. 12709367