Paralogue Annotation for RYR1 residue 2129

Residue details

Gene: RYR1
Reference Sequences: Ensembl variant: ENST00000359596 / ENSP00000352608
Amino Acid Position: 2129
Reference Amino Acid: D - Aspartate
Protein Domain:


Paralogue Variants mapped to RYR1 residue 2129

No paralogue variants have been mapped to residue 2129 for RYR1.



RYR1SHMVVRWAQEDFVQSPELVRAMFSLLHRQY>D<GLGELLRALPRAYTISPSSVEDTMSLLECL2159
RYR2SETMVRWAQESVIEDPELVRAMFVLLHRQY>D<GIGGLVRALPKTYTINGVSVEDTINLLASL2123
RYR3SQTMICWAQEDQIQDSELVRMMFNLLRRQY>D<SIGELLQALRKTYTISHTSVSDTINLLAAL2021
cons                              > <                              

See full Alignment of Paralogues


Known Variants in RYR1

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.D2129Ec.6387C>G Other MyopathySIFT:
Polyphen:
ReportsOther Myopathy Identification of a novel mutation in the ryanodine receptor gene (RYR1) in patients with malignant hyperthermia. Hum Mutat. 2001 17(3):238. 11241852
p.D2129Nc.6385G>A Other Disease PhenotypeSIFT:
Polyphen:
ReportsOther Disease Phenotype Mutations in RYR1 are a common cause of exertional myalgia and rhabdomyolysis. Neuromuscul Disord. 2013 23(7):540-8. doi: 10.1016/j.nmd.2013.03.008. 23628358
Other Disease Phenotype RYR1-related myopathies: a wide spectrum of phenotypes throughout life. Eur J Neurol. 2015 22(7):1094-112. doi: 10.1111/ene.12713. 25960145