Paralogue Annotation for RYR1 residue 2141

Residue details

Gene: RYR1
Reference Sequences: Ensembl variant: ENST00000359596 / ENSP00000352608
Amino Acid Position: 2141
Reference Amino Acid: A - Alanine
Protein Domain:


Paralogue Variants mapped to RYR1 residue 2141

No paralogue variants have been mapped to residue 2141 for RYR1.



RYR1VQSPELVRAMFSLLHRQYDGLGELLRALPR>A<YTISPSSVEDTMSLLECLGQIRSLLIVQMG2171
RYR2IEDPELVRAMFVLLHRQYDGIGGLVRALPK>T<YTINGVSVEDTINLLASLGQIRSLLSVRMG2135
RYR3IQDSELVRMMFNLLRRQYDSIGELLQALRK>T<YTISHTSVSDTINLLAALGQIRSLLSVRMG2033
cons                              > <                              

See full Alignment of Paralogues


Known Variants in RYR1

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.A2141Vc.6422C>T Putative BenignSIFT:
Polyphen: benign