Paralogue Annotation for RYR1 residue 2148

Residue details

Gene: RYR1
Reference Sequences: Ensembl variant: ENST00000359596 / ENSP00000352608
Amino Acid Position: 2148
Reference Amino Acid: S - Serine
Protein Domain:


Paralogue Variants mapped to RYR1 residue 2148

No paralogue variants have been mapped to residue 2148 for RYR1.



RYR1RAMFSLLHRQYDGLGELLRALPRAYTISPS>S<VEDTMSLLECLGQIRSLLIVQMGPQEENLM2178
RYR2RAMFVLLHRQYDGIGGLVRALPKTYTINGV>S<VEDTINLLASLGQIRSLLSVRMGKEEEKLM2142
RYR3RMMFNLLRRQYDSIGELLQALRKTYTISHT>S<VSDTINLLAALGQIRSLLSVRMGKEEELLM2040
cons                              > <                              

See full Alignment of Paralogues


Known Variants in RYR1

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.S2148Fc.6443C>T Other MyopathySIFT:
Polyphen:
ReportsOther Myopathy Diagnosis and etiology of congenital muscular dystrophy: We are halfway there. Ann Neurol. 2016 80(1):101-11. doi: 10.1002/ana.24687. 27159402