Paralogue Annotation for RYR1 residue 2154

Residue details

Gene: RYR1
Reference Sequences: Ensembl variant: ENST00000359596 / ENSP00000352608
Amino Acid Position: 2154
Reference Amino Acid: S - Serine
Protein Domain:


Paralogue Variants mapped to RYR1 residue 2154

No paralogue variants have been mapped to residue 2154 for RYR1.



RYR1LHRQYDGLGELLRALPRAYTISPSSVEDTM>S<LLECLGQIRSLLIVQMGPQEENLMIQSIGN2184
RYR2LHRQYDGIGGLVRALPKTYTINGVSVEDTI>N<LLASLGQIRSLLSVRMGKEEEKLMIRGLGD2148
RYR3LRRQYDSIGELLQALRKTYTISHTSVSDTI>N<LLAALGQIRSLLSVRMGKEEELLMINGLGD2046
cons                              > <                              

See full Alignment of Paralogues


Known Variants in RYR1

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.S2154Rc.6462C>A Putative BenignSIFT: tolerated
Polyphen: benign