Paralogue Annotation for RYR1 residue 2203

Residue details

Gene: RYR1
Reference Sequences: Ensembl variant: ENST00000359596 / ENSP00000352608
Amino Acid Position: 2203
Reference Amino Acid: M - Methionine
Protein Domain:


Paralogue Variants mapped to RYR1 residue 2203

No paralogue variants have been mapped to residue 2203 for RYR1.



RYR1QEENLMIQSIGNIMNNKVFYQHPNLMRALG>M<HETVMEVMVNVLGGGESKEIRFPKMVTSCC2233
RYR2EEEKLMIRGLGDIMNNKVFYQHPNLMRALG>M<HETVMEVMVNVLGGGESKEITFPKMVANCC2197
RYR3EEELLMINGLGDIMNNKVFYQHPNLMRVLG>M<HETVMEVMVNVLGT-EKSQIAFPKMVASCC2094
cons                              > <                              

See full Alignment of Paralogues


Known Variants in RYR1

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.M2203Vc.6607A>G Putative BenignSIFT:
Polyphen: benign