Paralogue Annotation for RYR1 residue 2248

Residue details

Gene: RYR1
Reference Sequences: Ensembl variant: ENST00000359596 / ENSP00000352608
Amino Acid Position: 2248
Reference Amino Acid: R - Arginine
Protein Domain:


Paralogue Variants mapped to RYR1 residue 2248

ParalogueVariantAssociated DiseaseMapping QualityConsensusPubmed
RYR2K2212NCatecholaminergic polymorphic ventricular tachycarMedium9 22787013, 24025405

To assess whether the paralogue annotation here confidently predicts that variation at this residue is pathogenic, it is important to check the reports in the Pubmed links above to ascertain that the mutations in these paralogues have been proved likely to be disease-causing. It is also important to check that the direction of effect of the variant in the paralogue is compatible with your observed phenotype in RYR1.



RYR1GESKEIRFPKMVTSCCRFLCYFCRISRQNQ>R<SMFDHLSYLLENSGIG--L-GMQGSTPLDV2275
RYR2GESKEITFPKMVANCCRFLCYFCRISRQNQ>K<AMFDHLSYLLENSSVGLASPAMRGSTPLDV2242
RYR3-EKSQIAFPKMVASCCRFLCYFCRISRQNQ>K<AMFEHLSYLLENSSVGLASPSMRGSTPLDV2139
cons                              > <                              

See full Alignment of Paralogues


Known Variants in RYR1

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.R2248Hc.6743G>A Putative BenignSIFT:
Polyphen: possibly damaging
p.R2248Cc.6742C>T Other MyopathySIFT:
Polyphen:
ReportsOther Myopathy Next-generation Sequencing of RYR1 and CACNA1S in Malignant Hyperthermia and Exertional Heat Illness. Anesthesiology. 2015 122(5):1033-46. doi: 10.1097/ALN.0000000000000610. 25658027