Paralogue Annotation for RYR1 residue 2280

Residue details

Gene: RYR1
Reference Sequences: Ensembl variant: ENST00000359596 / ENSP00000352608
Amino Acid Position: 2280
Reference Amino Acid: V - Valine
Protein Domain:


Paralogue Variants mapped to RYR1 residue 2280

No paralogue variants have been mapped to residue 2280 for RYR1.



RYR1HLSYLLENSGIG--L-GMQGSTPLDVAAAS>V<IDNNELALALQEQDLEKVVSYLAGCGLQSC2310
RYR2HLSYLLENSSVGLASPAMRGSTPLDVAAAS>V<MDNNELALALREPDLEKVVRYLAGCGLQSC2277
RYR3HLSYLLENSSVGLASPSMRGSTPLDVAASS>V<MDNNELALSLEEPDLEKVVTYLAGCGLQSC2174
cons                              > <                              

See full Alignment of Paralogues


Known Variants in RYR1

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.V2280Ic.6838G>A Other MyopathySIFT:
Polyphen:
ReportsOther Myopathy Mutations in the RYR1 gene in Italian patients at risk for malignant hyperthermia: evidence for a cluster of novel mutations in the C-terminal region. Cell Calcium. 2002 32(3):143-51. 12208234