Paralogue Annotation for RYR1 residue 2375

Residue details

Gene: RYR1
Reference Sequences: Ensembl variant: ENST00000359596 / ENSP00000352608
Amino Acid Position: 2375
Reference Amino Acid: G - Glycine
Protein Domain:


Paralogue Variants mapped to RYR1 residue 2375

ParalogueVariantAssociated DiseaseMapping QualityConsensusPubmed
RYR2G2342RCatecholaminergic polymorphic ventricular tachycarHigh9 26114861

To assess whether the paralogue annotation here confidently predicts that variation at this residue is pathogenic, it is important to check the reports in the Pubmed links above to ascertain that the mutations in these paralogues have been proved likely to be disease-causing. It is also important to check that the direction of effect of the variant in the paralogue is compatible with your observed phenotype in RYR1.



RYR1SVEENANVVVRLLIRKPECFGPALRGEGGS>G<LLAAIEEAIRISEDPARDGPGIRRDRRREH2405
RYR2SVEENANVVVRLLIRRPECFGPALRGEGGN>G<LLAAMEEAIKIAEDPSRDGPSPNS-GSSKT2371
RYR3SVEENASVVVKLLIRRPECFGPALRGEGGN>G<LLAAMQGAIKISENPALDLPSQGY-KREVS2268
cons                              > <                              

See full Alignment of Paralogues


Known Variants in RYR1

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.G2375Ac.7124G>C Other MyopathySIFT:
Polyphen:
ReportsOther Myopathy [Current aspects of the diagnosis of malignant hyperthermia]. Anaesthesist. 2002 51(11):904-13. 12434264
Other Myopathy Functional characterization of malignant hyperthermia-associated RyR1 mutations in exon 44, using the human myotube model. Neuromuscul Disord. 2004 14(7):429-37. 15210166