Paralogue Annotation for RYR1 residue 2391

Residue details

Gene: RYR1
Reference Sequences: Ensembl variant: ENST00000359596 / ENSP00000352608
Amino Acid Position: 2391
Reference Amino Acid: A - Alanine
Protein Domain:


Paralogue Variants mapped to RYR1 residue 2391

No paralogue variants have been mapped to residue 2391 for RYR1.



RYR1PECFGPALRGEGGSGLLAAIEEAIRISEDP>A<RDGPGIRRDRRREHFGEEPPEENRVHLGHA2421
RYR2PECFGPALRGEGGNGLLAAMEEAIKIAEDP>S<RDGPSPNS-GSSKTLDTEEEEDDTIHMGNA2387
RYR3PECFGPALRGEGGNGLLAAMQGAIKISENP>A<LDLPSQGY-KREVSTGDDEEEEEIVHMGNA2284
cons                              > <                              

See full Alignment of Paralogues


Known Variants in RYR1

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.A2391Vc.7172C>T Putative BenignSIFT: deleterious
Polyphen: possibly damaging