Paralogue Annotation for RYR1 residue 2439

Residue details

Gene: RYR1
Reference Sequences: Ensembl variant: ENST00000359596 / ENSP00000352608
Amino Acid Position: 2439
Reference Amino Acid: E - Glutamate
Protein Domain:


Paralogue Variants mapped to RYR1 residue 2439

No paralogue variants have been mapped to residue 2439 for RYR1.



RYR1EPPEENRVHLGHAIMSFYAALIDLLGRCAP>E<MHLIQAGKGEALRIRAILRSLVPLEDLVGI2469
RYR2EEEEDDTIHMGNAIMTFYSALIDLLGRCAP>E<MHLIHAGKGEAIRIRSILRSLIPLGDLVGV2435
RYR3DEEEEEIVHMGNAIMSFYSALIDLLGRCAP>E<MHLIQTGKGEAIRIRSILRSLVPTEDLVGI2332
cons                              > <                              

See full Alignment of Paralogues


Known Variants in RYR1

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.E2439Dc.7317G>C Other MyopathySIFT:
Polyphen:
ReportsOther Myopathy Frequency and localization of mutations in the 106 exons of the RYR1 gene in 50 individuals with malignant hyperthermia. Hum Mutat. 2006 27(8):830. 16835904