Paralogue Annotation for RYR1 residue 2517

Residue details

Gene: RYR1
Reference Sequences: Ensembl variant: ENST00000359596 / ENSP00000352608
Amino Acid Position: 2517
Reference Amino Acid: F - Phenylalanine
Protein Domain:


Paralogue Variants mapped to RYR1 residue 2517

ParalogueVariantAssociated DiseaseMapping QualityConsensusPubmed
RYR2F2483ICatecholaminergic polymorphic ventricular tachycarHigh9 22178870, 24025405, 23684427

To assess whether the paralogue annotation here confidently predicts that variation at this residue is pathogenic, it is important to check the reports in the Pubmed links above to ascertain that the mutations in these paralogues have been proved likely to be disease-causing. It is also important to check that the direction of effect of the variant in the paralogue is compatible with your observed phenotype in RYR1.



RYR1QPKMSASFVPDHKASMVLFLDRVYGIENQD>F<LLHVLDVGFLPDMRAAASLDTATFSTTEMA2547
RYR2EPDMSAGFCPDHKAAMVLFLDRVYGIEVQD>F<LLHLLEVGFLPDLRAAASLDTAALSATDMA2513
RYR3EPDMAANFCPDHKAPMVLFLDRVYGIKDQT>F<LLHLLEVGFLPDLRASASLDTVSLSTTEAA2410
cons                              > <                              

See full Alignment of Paralogues


Known Variants in RYR1

There are currently no reported variants at residue 2517 for RYR1.