Paralogue Annotation for RYR1 residue 2585

Residue details

Gene: RYR1
Reference Sequences: Ensembl variant: ENST00000359596 / ENSP00000352608
Amino Acid Position: 2585
Reference Amino Acid: T - Threonine
Protein Domain:


Paralogue Variants mapped to RYR1 residue 2585

No paralogue variants have been mapped to residue 2585 for RYR1.



RYR1CLAVLPLITKCAPLFAGTEHRAIMVDSMLH>T<VYRLSRGRSLTKAQRDVIEDCLMSLCRYIR2615
RYR2CTAVLPLLTRCAPLFAGTEHHASLIDSLLH>T<VYRLSKGCSLTKAQRDSIEVCLLSICGQLR2581
RYR3CSAVLPLLTRCAPLFAGTEHCTSLIDSTLQ>T<IYRLSKGRSLTKAQRDTIEECLLAICNHLR2478
cons                              > <                              

See full Alignment of Paralogues


Known Variants in RYR1

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.T2585Ic.7754C>T Putative BenignSIFT: deleterious
Polyphen: benign