Paralogue Annotation for RYR1 residue 2615

Residue details

Gene: RYR1
Reference Sequences: Ensembl variant: ENST00000359596 / ENSP00000352608
Amino Acid Position: 2615
Reference Amino Acid: R - Arginine
Protein Domain:


Paralogue Variants mapped to RYR1 residue 2615

No paralogue variants have been mapped to residue 2615 for RYR1.



RYR1TVYRLSRGRSLTKAQRDVIEDCLMSLCRYI>R<PSMLQHLLRRLVFDVPILNEFAKMPLKLLT2645
RYR2TVYRLSKGCSLTKAQRDSIEVCLLSICGQL>R<PSMMQHLLRRLVFDVPLLNEHAKMPLKLLT2611
RYR3TIYRLSKGRSLTKAQRDTIEECLLAICNHL>R<PSMLQQLLRRLVFDVPQLNEYCKMPLKLLT2508
cons                              > <                              

See full Alignment of Paralogues


Known Variants in RYR1

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.R2615Hc.7844G>A Putative BenignSIFT:
Polyphen: benign
p.R2615Cc.7843C>T Other MyopathySIFT:
Polyphen:
ReportsOther Myopathy Ryanodine myopathies without central cores--clinical, histopathologic, and genetic description of three cases. Pediatr Neurol. 2014 51(2):275-8. doi: 10.1016/j.pediatrneurol.2014.04. 24950660