Paralogue Annotation for RYR1 residue 2634

Residue details

Gene: RYR1
Reference Sequences: Ensembl variant: ENST00000359596 / ENSP00000352608
Amino Acid Position: 2634
Reference Amino Acid: N - Asparagine
Protein Domain:


Paralogue Variants mapped to RYR1 residue 2634

No paralogue variants have been mapped to residue 2634 for RYR1.



RYR1EDCLMSLCRYIRPSMLQHLLRRLVFDVPIL>N<EFAKMPLKLLTNHYERCWKYYCLPTGWANF2664
RYR2EVCLLSICGQLRPSMMQHLLRRLVFDVPLL>N<EHAKMPLKLLTNHYERCWKYYCLPGGWGNF2630
RYR3EECLLAICNHLRPSMLQQLLRRLVFDVPQL>N<EYCKMPLKLLTNHYEQCWKYYCLPSGWGSY2527
cons                              > <                              

See full Alignment of Paralogues


Known Variants in RYR1

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.N2634Kc.7902C>A Putative BenignSIFT:
Polyphen: benign