Paralogue Annotation for RYR1 residue 2645

Residue details

Gene: RYR1
Reference Sequences: Ensembl variant: ENST00000359596 / ENSP00000352608
Amino Acid Position: 2645
Reference Amino Acid: T - Threonine
Protein Domain:


Paralogue Variants mapped to RYR1 residue 2645

No paralogue variants have been mapped to residue 2645 for RYR1.



RYR1RPSMLQHLLRRLVFDVPILNEFAKMPLKLL>T<NHYERCWKYYCLPTGWANFGVTSEEELHLT2675
RYR2RPSMMQHLLRRLVFDVPLLNEHAKMPLKLL>T<NHYERCWKYYCLPGGWGNFGAASEEELHLS2641
RYR3RPSMLQQLLRRLVFDVPQLNEYCKMPLKLL>T<NHYEQCWKYYCLPSGWGSYGLAVEEELHLT2538
cons                              > <                              

See full Alignment of Paralogues


Known Variants in RYR1

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.T2645Ac.7933A>G Putative BenignSIFT:
Polyphen: benign