Paralogue Annotation for RYR1 residue 2659

Residue details

Gene: RYR1
Reference Sequences: Ensembl variant: ENST00000359596 / ENSP00000352608
Amino Acid Position: 2659
Reference Amino Acid: T - Threonine
Protein Domain:


Paralogue Variants mapped to RYR1 residue 2659

No paralogue variants have been mapped to residue 2659 for RYR1.



RYR1DVPILNEFAKMPLKLLTNHYERCWKYYCLP>T<GWANFGVTSEEELHLTRKLFWGIFDSLAHK2689
RYR2DVPLLNEHAKMPLKLLTNHYERCWKYYCLP>G<GWGNFGAASEEELHLSRKLFWGIFDALSQK2655
RYR3DVPQLNEYCKMPLKLLTNHYEQCWKYYCLP>S<GWGSYGLAVEEELHLTEKLFWGIFDSLSHK2552
cons                              > <                              

See full Alignment of Paralogues


Known Variants in RYR1

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.T2659Mc.7976C>T Putative BenignSIFT:
Polyphen: benign